PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI07G19460.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 340aa    MW: 35144.7 Da    PI: 6.1552
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI07G19460.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.81.1e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+ lv +v+++G+g+W++++ + g+ R+ k+c++rw +yl
  OMERI07G19460.1 14 KGPWTPEEDLVLVSYVQEHGPGNWRAVPTRTGLMRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding51.22.9e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +E++l+v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  OMERI07G19460.1  67 RGNFTDQEEKLIVHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-24564IPR009057Homeodomain-like
PROSITE profilePS5129425.358965IPR017930Myb domain
SuperFamilySSF466895.99E-3011108IPR009057Homeodomain-like
SMARTSM007172.9E-131363IPR001005SANT/Myb domain
PfamPF002491.9E-161461IPR001005SANT/Myb domain
CDDcd001671.51E-111661No hitNo description
Gene3DG3DSA:1.10.10.603.7E-2465116IPR009057Homeodomain-like
SMARTSM007173.2E-1666114IPR001005SANT/Myb domain
PROSITE profilePS5129420.60966116IPR017930Myb domain
PfamPF002495.8E-1567112IPR001005SANT/Myb domain
CDDcd001677.18E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0009617Biological Processresponse to bacterium
GO:0009626Biological Processplant-type hypersensitive response
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042761Biological Processvery long-chain fatty acid biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MVRPPCCDKD GVKKGPWTPE EDLVLVSYVQ EHGPGNWRAV PTRTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF TDQEEKLIVH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKRKLQGGG  120
GGGDGDGGAA GDAVYSKPAA QRPASSSKGQ WERRLQTDID MARRALREAL TSLDDKPHQP  180
DAAAGGGGAT TGAAASAGTG TGAGADSPAA SSTSGASQCS PSSAGYVLTT ENISRMLDGW  240
ARKKGGGGGR RAAGSGPATP GVTESASGSS EASEVSYGGT ALSAAAAPAS AFEYETKPTV  300
AAAGDAGDET QLSAIESWLF ADADGIESGS LLDAAMDYTF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C9e-28141164105C-Myb DNA-Binding Domain
1msf_C9e-28141164105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00386DAPTransfer from AT3G28910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3234800.0AY323480.1 Oryza sativa (japonica cultivar-group) putative myb protein (MYB) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645343.11e-165PREDICTED: transcription factor MYB30
TrEMBLA0A0E0EER80.0A0A0E0EER8_9ORYZ; Uncharacterized protein
STRINGORGLA07G0180600.11e-168(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62470.24e-89myb domain protein 96